PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G327200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 488aa    MW: 52716.8 Da    PI: 6.1977
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G327200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS288.51.8e-88184613374
                GRAS   3 elLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlar.svselykal.ppsetseknsseelaalklfsevsPi 90 
                         ++L ecA  v++g++e+a ++L r   la+++g  p+ Rl+  ++  La+rl r +v+++++al  ps+    +   + aa++ f+e+sP+
  Sevir.7G327200.1.p  18 RALCECAADVEAGSMEKAARCLLRATGLAASTGdGPLPRLVVPVADCLARRLIRpMVPGVADALiDPSDHL--DRRCVRAAHRSFFELSPF 106
                         689*******************9999998888857*******************99*****9994444443..44555578899******* PP

                GRAS  91 lkfshltaNqaIleavegeervHiiDfd..isqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                         +k +  +aN+ Ilea+e+e+ vH+iDf   + q+ QW+ Ll+ + sRpeg+p+lR+  v++    + e l ++ e L++ A+el+vp++ +
  Sevir.7G327200.1.p 107 PKAAVAVANRVILEAMENEKNVHVIDFAgpAAQPCQWIQLLRDFRSRPEGAPHLRLSIVHD----DDEFLANVSESLTDEADELDVPLQVH 193
                         ***************************75589*****************************....99************************ PP

                GRAS 180 vlvakrledleleeL....rvkpgEalaVnlvlqlhrll.................................................... 214
                           va ++e+l++++L     +k+gEa a+ + l+lhrll                                                    
  Sevir.7G327200.1.p 194 C-VAAQIETLDFNDLhgvlGLKSGEARAIICTLRLHRLLaaaddaassfsaghrfnqtasvarlqemasdscppsigggaaceeddpyyrs 283
                         *.7999*******9966667889******************************************************************** PP

                GRAS 215 .............desvsleserdevLklvks.lsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres....eerikvEr 287
                                        + +++ +   +L++ +  +sPk+vv++eqea+hn+ sF +rf+eal++y+a +dsl+a +++       er+ vEr
  Sevir.7G327200.1.p 284 patplgfvsppltTPPFQMPPALAGFLSAARAtVSPKIVVLAEQEASHNGVSFRKRFAEALQHYAAAYDSLDAAAAAYRrpaaAERAEVER 374
                         ***********99666777777778*****9538*************************************8776554445679******* PP

                GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                         ++lg+ei++v+  ega+rrerh +l++W  r+e aGF+ vpls+ a  q + +lr++++ g +  e+ g+l+l+W++ pL+svSaWr
  Sevir.7G327200.1.p 375 AVLGEEIRDVLLREGARRRERHDRLHQWALRMEVAGFRGVPLSYIALRQGDDVLRRCGVGGCESREHGGCLLLCWRSWPLYSVSAWR 461
                         **************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.1111441IPR005202Transcription factor GRAS
PfamPF035146.1E-8618461IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MHPPTENGPD SRLAHLGRAL CECAADVEAG SMEKAARCLL RATGLAASTG DGPLPRLVVP  60
VADCLARRLI RPMVPGVADA LIDPSDHLDR RCVRAAHRSF FELSPFPKAA VAVANRVILE  120
AMENEKNVHV IDFAGPAAQP CQWIQLLRDF RSRPEGAPHL RLSIVHDDDE FLANVSESLT  180
DEADELDVPL QVHCVAAQIE TLDFNDLHGV LGLKSGEARA IICTLRLHRL LAAADDAASS  240
FSAGHRFNQT ASVARLQEMA SDSCPPSIGG GAACEEDDPY YRSPATPLGF VSPPLTTPPF  300
QMPPALAGFL SAARATVSPK IVVLAEQEAS HNGVSFRKRF AEALQHYAAA YDSLDAAAAA  360
YRRPAAAERA EVERAVLGEE IRDVLLREGA RRRERHDRLH QWALRMEVAG FRGVPLSYIA  420
LRQGDDVLRR CGVGGCESRE HGGCLLLCWR SWPLYSVSAW RPDRDAAYGV GCDSVSTAST  480
AGSCTWF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-15316461231375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980153.20.0PREDICTED: scarecrow-like protein 3
TrEMBLK3YD850.0K3YD85_SETIT; Uncharacterized protein
STRINGSi012188m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.14e-61scarecrow-like 3